PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn173251
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 323aa    MW: 36267.7 Da    PI: 5.3553
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn173251genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.7e-175397147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
       Achn173251 53 RGRFSFEEEETIIQLHSVLGNK-WSAIAARLP-GRTDNEIKNYWNTH 97
                     89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.28E-2133106IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-103360IPR009057Homeodomain-like
PROSITE profilePS500904.173447IPR017877Myb-like domain
PROSITE profilePS5129425.13748102IPR017930Myb domain
SMARTSM007174.8E-1652100IPR001005SANT/Myb domain
PfamPF002491.9E-155397IPR001005SANT/Myb domain
CDDcd001673.76E-125598No hitNo description
Gene3DG3DSA:1.10.10.602.4E-226199IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MNNKINKILK LNDLNYQCGP LGGPSTAEAN GLQRCGKSCR LRWTNYLRPD IKRGRFSFEE  60
EETIIQLHSV LGNKWSAIAA RLPGRTDNEI KNYWNTHIRK RLLKMGIDPV THSPRLDLLD  120
LSTILHSAQL NLSNLLSLQT LANPELLRVV TTLLASNHEN SQNVSQKLQE SQIFNTQLQN  180
QNLMTQPNFP MEEIPLNTSS GDPHTSNFNQ TQLAQGMDMG HFPINSTDLN CQNFQENVAP  240
SSLNGNFGTL PNFGQNMFDQ MKTSENLAFD SVISTPMSSP TPLTSSSTFI NSSSTEDERE  300
SYCSNMLKFE IPESFLDFDD FM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-213410237105MYB PROTO-ONCOGENE PROTEIN
1mse_C6e-213410237105C-Myb DNA-Binding Domain
1msf_C6e-213410237105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010277911.11e-105PREDICTED: transcription factor MYB39
TrEMBLV4W3V41e-103V4W3V4_9R
STRINGPOPTR_0019s14070.11e-101(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.15e-66MYB-like 102